What Is Normal Changes In A Child’s Growth Curve?

I am asked to evaluate growth curves and assess normal weight gain in infants, toddlers and children on an almost daily basis. Naturally, a decline or acceleration in a child’s growth curves can make a caregiver extremely anxious about their child’s nutrition and development. However, some fluctuations in growth curves may be perfectly normal and no cause for alarm.

The World Health Organization’s growth charts for children at birth to five years of age were developed from large samplings of children from around the world and raised in optimal conditions. They allow a health professional to compare a child’s growth to a population of the same age and gender.

Unfortunately, the growth curve tool does not always paint an accurate picture of a child’s individual growth. If your doctor uses a standard growth curve, it may not take into consideration your ethnicity. These curves are based on Caucasian children and those with Hispanic or Asian heritage tend to be smaller. Also, healthy kids come in a wide range of shapes and sizes. Not all children grow at this neat, steady rate either. It is not uncommon to see a once chubby infant or young toddler develop into a lanky kid. Or, a skinny little toddler turn into an average sized kid.

Some children do follow the same percentile for weight for most of childhood. Other children growing normally may change percentiles in their first two or three years. The Canadian Society for Pediatrics published a study on growth curves using the National Center for Health Statistics (CDC) growth charts. This study showed that as many as 30% of normal children crossed one major percentile line and 23% crossed two in the first two years of life. All of these children were healthy.

Birth weight and length are strong predictors of subsequent growth but do not always reflect a child’s “genetic potential”. Genetic potential factors in the mother and the father’s adult height. Intrauterine growth may be affected by external factors such as maternal size, malnutrition or smoking or gestational diabetes. After birth and into childhood, there may be some ‘catch-up’ if an infant was born smaller than her/his genetic potential, or a ‘catch-down’ if the child was born larger than his/her genetic potential. This means that a small newborn destined to be a big child might grow faster in the first two years than a big baby who is going to be a small child.

What does normal growth look like?

• Birth to 12 months: Infants add 10 inches in length and triple their birth weight.

• 12 to 24 months: Toddlers add 5 inches and 6 pounds.

• 2 to 10 years: Most kids have settled into their growth patterns, adding about 2 1/2 inches and 6 pounds each year.

• Puberty: Girls grow up to 9 inches and gain 15 to 55 pounds; boys grow up to 11 inches and gain up to 65 pounds.

All changes in growth curves should be evaluated. Drops in over two major percentiles on the growth curve in weight gain may be a sign of a nutritional deficiency or medical issue. Failure to thrive is typically seen first as a drop in weight percentiles followed by a drop in length percentiles. A nutritional history should be obtained and caloric intake calculated by a dietitian. All children trending down on the growth curve should see a specialist to check for errors in metabolism, malabsorption of nutrients, or chronic disease. Talk to your doctor if you see any of the following signs in your child:

• His or her height seems off, given the height of his parents or siblings.
• He or she is nowhere near the averages
• He or she drops over 20 percentile points from one year to the next and/or crosses over two major percentiles lines.
• He or she is gaining weight much more rapidly than he or she is gaining height.

It is important to keep in mind that children grow at different rates throughout the year. It is normal for a child to have a sudden growth spurt followed by little or no weight gain or growth. A rapid change in height may cause a child’s body mass index (BMI) to appear lower than previously recorded until weight gain catches up. It may be perfectly normal for a child to look very thin and drop percentiles at one doctor’s visit and then make up for that with an increase in weight gain a few weeks or months later. It may also be normal for your child’s curve to fluctuate at various points as well. Give things a few months before starting to become too anxious about weight gain or growth. Most of the time you just have to wait until the next growth spurt-which may be right around the corner.

Your Child Has a Problem

As a psychologist it is my job to help figure out the differences between can or can’t and will or won’t.

Some parents might be worried about their children now that they have been in class for the past few weeks. Others will probably be shocked when they receive the first report card of the year. Maybe you haven’t been paying enough attention or maybe your child has been conning you into believing that things are good.

It may be a parenting problem: Why is your child late, missing or not prepared to learn? Perhaps they have not been doing their homework, staying up too late or worrying about stressful situations at home. When a parent is not available or interested in helping the child do well, it is easy for that child to fall into bad habits. All of us want to do what we like and avoid the things that we don’t like but avoidance of the basics by you or by the child will not have a good outcome. And don’t kid yourself. Just because your child knows how to do something that you can’t do just as downloading an app or using a computer doesn’t mean that s/he is smart or knows how to use their brain effectively. I know many intelligent people who do poorly in life. I also know people with average intelligence who do well because they apply themselves.

It may be an academic problem: Sometimes there are simple reasons why a child does poorly at school. Perhaps s/he can’t read and has been able to hide this from adults. There might have an undiagnosed hearing problem. The child may be so frightened by a bully that it is hard to concentrate. Learning disabilities and negative environmental factors can not only hamper a child’s opportunity to do well but also steal their confidence. If the child does well in areas outside of school but doesn’t do well academically, then it makes good sense for parents to meet with the teacher and/or principal to discuss barriers to progress and create solutions to help the child. Think teamwork.

It may be a both: Sometimes a child just doesn’t want to follow rules or thinks that his/her goals and ideas are superior to traditional paths. Because peers are very important, the friends a child chooses will influence values, choices and attitudes. It’s not that the child can’t do things but rather that they won’t. On the other hand, a child may have a low self-image and, as a result, can’t progress because they give up too soon. Some problems may actually be due to a disorder or mental illness such as depression, anxiety, ADHD. There may even be physical factors such as undiagnosed illness or low iron in the blood that interfere with a child being able to reach potential.

If your child has academic or behavioural problems, it will not help to ignore the situation or to yell. The first thing to do is to gather information so that you can determine the exact problem area. Research might include a physical checkup, psychological assessment or review of parenting techniques. Once you determine where the problem lies, a plan needs to be created that outlines appropriate goals and resources to be accessed. Thirdly, the child will need to have firm and consistent support from the parents in order to accomplish the goals that are laid out in the treatment plan.

It is annoying to hear parents state that it is the child’s problem if they don’t do well. It is the parents’ job to help figure out what is going wrong and how to partner with the child in a positive way. Blame should not be laid on anyone because that just wastes energy that could instead be focused on making changes that, over time, translate into progress and success for the child.

Be in Better Control by Having a Healthy Snack List for You and Your Children

Having a system in place is a better way of control than just picking at random. This especially applies when it comes to food which determines our health. This is why many people are looking for a healthy snack list, because sometimes is the need to take food throughout the day without accumulating too much fat in the body.

Our food today is very misleading. Most of the food out there may look good and healthy but actually leads to weight gain, diabetes and ongoing health issues. Just as an example, the name of fruit juice sounds very healthy? Of the shelf bought fruit juices are drinks that you want to avoid at all cost if you want to lose weight or stop butting it on. It’s not just the weight issue here, it is all about the added artificial sweeteners, preservatives and bad ingredients which become a serious health problem.

Getting peckish between meals, reaching for anything that is nearest to your fingertips is almost as disastrous as a train running of its rails. You need to have a healthy snack list. Having the right food even between meals is very important because it stabilizes your blood sugar levels and you won’t experience the cravings most dieters face. Here are some ideas and suggestions for a healthy snack list for you and your kids.

Healthy snack list for kids

A good, if not the best snack list for kids, especially those who are more towards the heavier side and eating the same food every day, includes: Sliced fruits, vegetable sandwiches, using whole grain if possible, cereal fries, baked beans, olives, cheese kabobs, frozen mini pizza, veggie platter, tortilla with grated cheese, baked beans, egg curry, apple fries, peanut butter, low-fat pudding, sliced chicken breast, black or low-calorie chocolate, popcorn, oatmeal cookies and smoothies.

Keep an eye on the calorie content while preparing their snacks; make sure you prepare food with the correct amount of calories. If you don’t know how to prepare some of these snacks, look for some great recipes and make fun food at home. There are so many high protein snacks for kids available. This will insure that your child is eating and living a healthy life. To make it perfect a good natural supplement could be added to the lunch box. Some come in a 30 ml (1 FL OZ) convenient pack, full of nutrition and natural fruits with a sweet tasty flavour.

Snack list for adults

Here is a list of snacks for adults; they are both veg and non veg. With this list you will get the necessary energy and satisfaction you need. Such as a bowl of mixed dry fruits, almonds, stacked vegetables, wheat bagels, whole grain sandwiches, sprouting beans, chicken breast, tortilla with peanut butter, oatmeal and milk, soybeans, and finally 100 calorie pack of cupcakes. The above list of snacks is high in fibre; this will take care of your belly shape and keep the weight steady as well. The snack can also help a lot in losing weight since they are low in calories. For those who hardly get time to prepare a proper meal, this can be of great help, better than eating junk foods that is both unhealthy and leads to weight gain. Adults can also use a supplement like mentioned above that is an all natural antioxidant blend.

Snack list for women

As a woman you are probably looking for low-carb food and some delicious snacks to break your monotonous daily routine. The following is a list of snacks that can help you lose weight. This will also help you stick to your diet and give you the satisfaction you want. The snack includes: Tofu, English muffin with peanut butter, tuna salad, deli turkey, fruit juice ice blocks (made from your own juice), sausages, jerky, popcorn, frozen fruit bars, fat-free pudding, vegetable soup, fruits, yogurt, mayonnaise and eggs.

With the list above you are getting nutritious healthy snacks instead of junk food. If you are on a diet and trying to lose weight, you don’t have to suppress your appetite all the time. Just enjoy some tasty snacks in between your meals. The above healthy snack list will make you feel better and greatly help you in losing weight.

My name is Josef Bichler I have a passion for wellness and showing others how to live healthy lives. I have corrected my own health problems with the use of alternatives only. I have helped countless others achieve their health objectives and detoxify their body for better weight solutions and also through understanding the benefits of a healthy diet menu. For more ongoing health information subscribe to my free weekly newsletters, this also gives you the opportunity for comments, suggestions and questions you may have, as well download my free e-book report to help making better food choices: http://www.healthythenaturalway.com

Article Source: http://EzineArticles.com/9199586

What Is Normal Changes In A Child’s Growth Curve?

I am asked to evaluate growth curves and assess normal weight gain in infants, toddlers and children on an almost daily basis. Naturally, a decline or acceleration in a child’s growth curves can make a caregiver extremely anxious about their child’s nutrition and development. However, some fluctuations in growth curves may be perfectly normal and no cause for alarm.

The World Health Organization’s growth charts for children at birth to five years of age were developed from large samplings of children from around the world and raised in optimal conditions. They allow a health professional to compare a child’s growth to a population of the same age and gender.

Unfortunately, the growth curve tool does not always paint an accurate picture of a child’s individual growth. If your doctor uses a standard growth curve, it may not take into consideration your ethnicity. These curves are based on Caucasian children and those with Hispanic or Asian heritage tend to be smaller. Also, healthy kids come in a wide range of shapes and sizes. Not all children grow at this neat, steady rate either. It is not uncommon to see a once chubby infant or young toddler develop into a lanky kid. Or, a skinny little toddler turn into an average sized kid.

Some children do follow the same percentile for weight for most of childhood. Other children growing normally may change percentiles in their first two or three years. The Canadian Society for Pediatrics published a study on growth curves using the National Center for Health Statistics (CDC) growth charts. This study showed that as many as 30% of normal children crossed one major percentile line and 23% crossed two in the first two years of life. All of these children were healthy.

Birth weight and length are strong predictors of subsequent growth but do not always reflect a child’s “genetic potential”. Genetic potential factors in the mother and the father’s adult height. Intrauterine growth may be affected by external factors such as maternal size, malnutrition or smoking or gestational diabetes. After birth and into childhood, there may be some ‘catch-up’ if an infant was born smaller than her/his genetic potential, or a ‘catch-down’ if the child was born larger than his/her genetic potential. This means that a small newborn destined to be a big child might grow faster in the first two years than a big baby who is going to be a small child.

What does normal growth look like?

• Birth to 12 months: Infants add 10 inches in length and triple their birth weight.

• 12 to 24 months: Toddlers add 5 inches and 6 pounds.

• 2 to 10 years: Most kids have settled into their growth patterns, adding about 2 1/2 inches and 6 pounds each year.

• Puberty: Girls grow up to 9 inches and gain 15 to 55 pounds; boys grow up to 11 inches and gain up to 65 pounds.

All changes in growth curves should be evaluated. Drops in over two major percentiles on the growth curve in weight gain may be a sign of a nutritional deficiency or medical issue. Failure to thrive is typically seen first as a drop in weight percentiles followed by a drop in length percentiles. A nutritional history should be obtained and caloric intake calculated by a dietitian. All children trending down on the growth curve should see a specialist to check for errors in metabolism, malabsorption of nutrients, or chronic disease. Talk to your doctor if you see any of the following signs in your child:

• His or her height seems off, given the height of his parents or siblings.
• He or she is nowhere near the averages
• He or she drops over 20 percentile points from one year to the next and/or crosses over two major percentiles lines.
• He or she is gaining weight much more rapidly than he or she is gaining height.

It is important to keep in mind that children grow at different rates throughout the year. It is normal for a child to have a sudden growth spurt followed by little or no weight gain or growth. A rapid change in height may cause a child’s body mass index (BMI) to appear lower than previously recorded until weight gain catches up. It may be perfectly normal for a child to look very thin and drop percentiles at one doctor’s visit and then make up for that with an increase in weight gain a few weeks or months later. It may also be normal for your child’s curve to fluctuate at various points as well. Give things a few months before starting to become too anxious about weight gain or growth. Most of the time you just have to wait until the next growth spurt-which may be right around the corner.

Easy Tips For Improving Your Nutrition With Juicing!

If you want to begin juicing, it is useful to have good advice. The healthy juicing strategies you are about to learn will help you start on the right foot. As you start to use these suggestions, juicing can become a lot more fun.

When juicing for health, the most effective ingredients you can use are greens like spinach, kale, broccoli, parsley, chard and the like. To get the most benefits, use at least 50% green vegetables in your juice drink. To add more flavor to your green vegetable juice add other vegetables or fruit. When you make juices primarily of fruit, they tend to be less healthy as they have much more sugar than those juices made with mostly greens.

Leisurely sip your juice, enjoying every mouthful. Try to savor the juice with time, and taste all of the flavors. Roll the juice through your mouth, allowing your entire tongue to experience the individual tastes, and begin the process of digestion.

Think of your juice in terms of color. As well as giving brilliant colors, the many varied vegetables, as well as fruits, are stocked with tons of vitamins and nutrients. These differences make for a broader flavor range to choose from and provide you with proper nutrition.

If your children are picky when it comes to vegetables, try serving them in a juice. The average child does not find vegetables appealing. When you mix vegetables in with fruits in a juice, it’ll taste delicious, and kids will have no idea that they’re drinking up vegetables.

Learn more about the ingredients you want to use before juicing. Due to the huge variety of market produce available, many differences can exist in the types of nutrients offered. Try to blend veggies and fruits to get an assortment of your daily needs. Not only will you give your body the nutrients it needs, but you will also find blends you may simply enjoy.

You can avoid getting pulp in juice by using a coffee filter. Some juices create a pulp consistency that you might not like. The pulp can be reduced or eliminated by straining the juice through a cheesecloth or a coffee filter.

Storing the fresh juice in a refrigerator is a really good idea, but keep in mind the juice will change colors. Brown or off-colored juice is less than appetizing. Add a couple of teaspoons of fresh lemon juice to the mixture and prevent the change. The lemon won’t change the flavor all that much, but will preserve the look of the juice.

When deciding on a juicer, look for one that is easy to take apart and clean. The longer it takes you to use and clean your appliance, the less likely you’ll want to use it. Make sure that you clean the juicer right away, because the components are easier to clean if the pulp has not dried.

Look into masticating juicers if you’re looking to make tasty, healthy juices. Masticating juicers come with extra features you won’t find on most other juices, such as features to grind, mill, and puree your juice. These juicers offer an array of juices you can make.

Add as many low-calorie foods to your juice to increase its nutritional value and help burn fat. Examples of calorie negative foods include herbs, kale and broccoli. Fruits high in fiber are always good choices as well, since the body breaks them down with thorough digestion.

Do not delay in serving your juice, after it has been prepared. Ideally you will drink your juice as soon as you make it.

Seal dark, green vegetables in an airtight zip-lock bag to keep them fresh before you throw them in a juicer. Before storing them in a bag, wash them and dry them with a towel before you refrigerate them.

Juices may have consequences when it comes to your teeth. Pay attention to how some juices can create unsightly stains on your tooth’s enamel. Juices from items, such as carrots or beets are likely to do this. Brush your teeth gently after drinking juices which cause your teeth to discolor.

The advice in this article is great in helping you stay on course in juicing. You need to print a copy, placing it on the refrigerator so you can look at it every day. Follow these useful juicing tips, and you will gradually be able to making juicing an integral part of your daily routine.

can-amusbiotekasian-transactionsbepartof2013ciociariaturismoamazingpeoplekostelecncltknoxsubrayadoemangakidzmaniathelemanowsouthtyroltravelswenzel-kerzenlinemansrodeomyprovodentistphoenixbadfaithlawrackitfasttheopticalvisionsitebb-todayceramgis-italiacommoditiesinvestment2p2dwildfrontiersclick-aroundgoldpowersoundfreaqgawebserviceschincoteaguehazardlabohazard-labohazardlabtutorindexsockethomeanrp-forumprivatbankmobilprivatbank-mobileprivatbankmobileinternational-studiessavenkeepsmithfamilyappealwhichbudgetmendeliantemoaktribenecispickoveritccanariasninchresearchvesseldatawforumaudio-occasioncapeplchayrettinkazaduokgovcuppicturemarketingxolomon4cdgvirginiatourismauditnetonlineriverscienceprojectsafeneighborhoodsriverscienceg20ngobunkertacticaljotasilasalle-montblanckabylehotnhatltobeuro-hostelsi365ais-usadiebahn-onlineanwbrestaurantsvijfjaarbiogasthesupremeslessupremesindianholidayctseducationimpact360si-mexicoboschcarservicetourdefrancellpftutorindexctseducationsoundfreaqchincoteaguechincoteaguegawebservicesbolderimageusvisascratchcardsmyprovodentistlinemansrodeowenzel-kerzensouthtyroltravelsthelemanowkidzmaniaecozoomstovephoenixbadfaithlaw